PTM Viewer PTM Viewer

AT4G03290.1

Arabidopsis thaliana [ath]

EF hand calcium-binding protein family

No PTMs currently found

PLAZA: AT4G03290
Gene Family: HOM05D000135
Other Names: NULL

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 154

MDSTELNRVFQMFDKDGDGKITTKELNESFKNLGIIIPEDELTQIIQKIDVNGDGCVDIEEFGELYKTIMVEDEDEVGEEDMKEAFNVFDRNGDGFITVDELKAVLSSLGLKQGKTLEECRKMIMQVDVDGDGRVNYMEFRQMMKKGRFFSSLS

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002048 1 72
77 150
Sites
Show Type Position
Active Site 14
Active Site 16
Active Site 18
Active Site 20
Active Site 25
Active Site 50
Active Site 52
Active Site 54
Active Site 56
Active Site 61
Active Site 90
Active Site 92
Active Site 94
Active Site 101
Active Site 128
Active Site 130
Active Site 132
Active Site 134
Active Site 139

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here